PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.012G127900.1
Common NameB456_012G127900, LOC105781065
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family bHLH
Protein Properties Length: 236aa    MW: 27283.2 Da    PI: 7.6877
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.012G127900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH331.1e-102775454
                        HHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHH CS
                 HLH  4 ahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksL 54
                          +++E++RR+++++ ++ L +llP++  ++++ ls  +   +Av+YI +L
  Gorai.012G127900.1 27 ERKIIEKNRRNHMKNLYASLNSLLPHR--NSKEPLSLPDQIDEAVNYITKL 75
                        5789**********************6..26666**************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd000834.58E-42277No hitNo description
PROSITE profilePS5088811.4462375IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SuperFamilySSF474598.24E-112393IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.103.7E-102594IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000105.7E-72775IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MELQMEYLAV DKQTEKKRAR CSSAKVERKI IEKNRRNHMK NLYASLNSLL PHRNSKEPLS  60
LPDQIDEAVN YITKLKTRMN ESREKKESLM SRKRSYTYAD TITSETTASL KSPEIKMNEN  120
GSAMEVVLTT GKDSQFMFYE MIYIIHQHGA QVLNASFSIL GNTVFHIVHA EIGAFVGAQI  180
IKDKLKRLVK GSSCEEELQQ ELWNYQIHPE TWDLNYEIYS ETWDFPIMLG STYMP*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012461092.11e-178PREDICTED: transcription factor bHLH118-like
TrEMBLA0A0D2V5U71e-178A0A0D2V5U7_G
STRINGVIT_12s0028g03550.t011e-64(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM12782592
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G20970.15e-34bHLH family protein
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]